PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Glyma.01G183900.1.p
Common NameGLYMA_01G183900, LOC102664012
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; fabids; Fabales; Fabaceae; Papilionoideae; Phaseoleae; Glycine; Soja
Family LBD
Protein Properties Length: 305aa    MW: 33546.5 Da    PI: 7.017
Description LBD family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Glyma.01G183900.1.pgenomeJGIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1DUF260138.91.8e-4381071100
               DUF260   1 aCaaCkvlrrkCakdCvlapyfpaeqpkkfanvhklFGasnvlkllkalpeeeredamsslvyeAearardPvyGavgvilklqqqleql 90 
                          +CaaCk+lrrkC+++Cv+apyfp ++p++fa+vhk+FGasnv kll++l+  +r+da++sl+yeAear+rdPvyG+vg+i+ lq++l+q 
  Glyma.01G183900.1.p   8 PCAACKFLRRKCTQECVFAPYFPPDNPQRFAYVHKVFGASNVAKLLNELSAAQRDDAVKSLAYEAEARLRDPVYGCVGLISVLQHKLRQI 97 
                          7***************************************************************************************** PP

               DUF260  91 kaelallkee 100
                          ++el+ +k+e
  Glyma.01G183900.1.p  98 QVELNNAKKE 107
                          *****99987 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS5089126.7297108IPR004883Lateral organ boundaries, LOB
PfamPF031952.8E-438105IPR004883Lateral organ boundaries, LOB
Sequence ? help Back to Top
Protein Sequence    Length: 305 aa     Download sequence    Send to blast
MSSSSNSPCA ACKFLRRKCT QECVFAPYFP PDNPQRFAYV HKVFGASNVA KLLNELSAAQ  60
RDDAVKSLAY EAEARLRDPV YGCVGLISVL QHKLRQIQVE LNNAKKELAT YIGPQAIQGI  120
PAPMLQQHPN NPFPGAMYGN MPTATAAVHG GQLVIRDAQP APQQQQQQIL EAQQLAAAVA  180
AREQQEMFRS YEHQQQQEFL RFSGGFDVGS ASSAGGFSQV SPAAASADQL SPSLALGSFD  240
NAYHMQQPQQ EEPHHHHHHP HHIPLEAQLL LPPQQKQQTH HESQLPLHQQ HSDNEERRSV  300
GPSC*
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankAC2351830.0AC235183.1 Glycine max strain Williams 82 clone GM_WBb0008G09, complete sequence.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_006573622.10.0PREDICTED: LOB domain-containing protein 36-like
RefseqXP_014631594.10.0PREDICTED: LOB domain-containing protein 36-like
RefseqXP_014631595.10.0PREDICTED: LOB domain-containing protein 36-like
RefseqXP_014631596.10.0PREDICTED: LOB domain-containing protein 36-like
RefseqXP_014631597.10.0PREDICTED: LOB domain-containing protein 36-like
SwissprotQ9FKZ36e-75LBD36_ARATH; LOB domain-containing protein 36
TrEMBLI1J9470.0I1J947_SOYBN; Uncharacterized protein
STRINGGLYMA01G39060.10.0(Glycine max)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
FabidsOGEF23533484
Representative plantOGRP6016318
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT5G66870.11e-70ASYMMETRIC LEAVES 2-like 1